Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in all proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein) |
Protein GroEL, A domain [52031] (3 species) |
Species Escherichia coli [TaxId:562] [52032] (11 PDB entries) |
Domain d1la1a_: 1la1 A: [73772] |
PDB Entry: 1la1 (more details), 2.06 Å
SCOP Domain Sequences for d1la1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1la1a_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli} dvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpl liiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigm elekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklqe rvaklaggvavi
Timeline for d1la1a_: