Lineage for d1l9nb4 (1l9n B:141-460)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188207Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 188208Superfamily d.3.1: Cysteine proteinases [54001] (8 families) (S)
  5. 188367Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein)
  6. 188368Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 188384Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (2 PDB entries)
  8. 188386Domain d1l9nb4: 1l9n B:141-460 [73747]
    Other proteins in same PDB: d1l9na1, d1l9na2, d1l9na3, d1l9nb1, d1l9nb2, d1l9nb3

Details for d1l9nb4

PDB Entry: 1l9n (more details), 2.1 Å

PDB Description: Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation

SCOP Domain Sequences for d1l9nb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9nb4 d.3.1.4 (B:141-460) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3}
dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr
daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswdgsveilknwk
ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld
kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq
lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk
ypegsdqerqvfqkalgklk

SCOP Domain Coordinates for d1l9nb4:

Click to download the PDB-style file with coordinates for d1l9nb4.
(The format of our PDB-style files is described here.)

Timeline for d1l9nb4: