Lineage for d1l9nb2 (1l9n B:480-593)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037080Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2037081Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2037082Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2037120Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (9 PDB entries)
  8. 2037135Domain d1l9nb2: 1l9n B:480-593 [73745]
    Other proteins in same PDB: d1l9na1, d1l9na4, d1l9nb1, d1l9nb4
    complexed with bgl, ca, cl

Details for d1l9nb2

PDB Entry: 1l9n (more details), 2.1 Å

PDB Description: three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation
PDB Compounds: (B:) Protein-glutamine glutamyltransferase E3

SCOPe Domain Sequences for d1l9nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9nb2 b.1.5.1 (B:480-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
psiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsat
msldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildn

SCOPe Domain Coordinates for d1l9nb2:

Click to download the PDB-style file with coordinates for d1l9nb2.
(The format of our PDB-style files is described here.)

Timeline for d1l9nb2: