Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
Protein Transglutaminase catalytic domain [54045] (4 species) |
Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (9 PDB entries) |
Domain d1l9na4: 1l9n A:141-460 [73743] Other proteins in same PDB: d1l9na1, d1l9na2, d1l9na3, d1l9nb1, d1l9nb2, d1l9nb3 complexed with bgl, ca, cl |
PDB Entry: 1l9n (more details), 2.1 Å
SCOPe Domain Sequences for d1l9na4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9na4 d.3.1.4 (A:141-460) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]} dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswdgsveilknwk ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk ypegsdqerqvfqkalgklk
Timeline for d1l9na4:
View in 3D Domains from other chains: (mouse over for more information) d1l9nb1, d1l9nb2, d1l9nb3, d1l9nb4 |