Lineage for d1l9na2 (1l9n A:480-593)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 222828Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 222829Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 222830Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 222860Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (2 PDB entries)
  8. 222861Domain d1l9na2: 1l9n A:480-593 [73741]
    Other proteins in same PDB: d1l9na1, d1l9na4, d1l9nb1, d1l9nb4

Details for d1l9na2

PDB Entry: 1l9n (more details), 2.1 Å

PDB Description: Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation

SCOP Domain Sequences for d1l9na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9na2 b.1.5.1 (A:480-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3}
psiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsat
msldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildn

SCOP Domain Coordinates for d1l9na2:

Click to download the PDB-style file with coordinates for d1l9na2.
(The format of our PDB-style files is described here.)

Timeline for d1l9na2: