Lineage for d1l9ma2 (1l9m A:479-593)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788243Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 788244Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 788245Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 788279Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (8 PDB entries)
  8. 788296Domain d1l9ma2: 1l9m A:479-593 [73733]
    Other proteins in same PDB: d1l9ma1, d1l9ma4, d1l9mb1, d1l9mb4

Details for d1l9ma2

PDB Entry: 1l9m (more details), 2.1 Å

PDB Description: three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E3

SCOP Domain Sequences for d1l9ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ma2 b.1.5.1 (A:479-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
epsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsa
tmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildn

SCOP Domain Coordinates for d1l9ma2:

Click to download the PDB-style file with coordinates for d1l9ma2.
(The format of our PDB-style files is described here.)

Timeline for d1l9ma2: