SCOP 1.65: Domain d1l9jt1: 1l9j T:36-253

Lineage for d1l9jt1 (1l9j T:36-253)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
core: barrel, partly opened; n*=5, S*=8; meander
Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
Protein Photosynthetic reaction centre [50348] (3 species)
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)
Domain d1l9jt1: 1l9j T:36-253 [73730]
Other proteins in same PDB: d1l9jc_, d1l9jd_, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt2
complexed with bcl, bph, cl, fe2, hem, lda, u10

Details for d1l9jt1

PDB Entry: 1l9j (more details), 3.25 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type I Co-Crystals

SCOP Domain Sequences for d1l9jt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9jt1 b.41.1.1 (T:36-253) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvva

SCOP Domain Coordinates for d1l9jt1:

Click to download the PDB-style file with coordinates for d1l9jt1.
(The format of our PDB-style files is described here.)

Timeline for d1l9jt1: