SCOP 1.61: Domain d1l9jh1: 1l9j H:36-253

Lineage for d1l9jh1 (1l9j H:36-253)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (28 PDB entries)

8. Domain d1l9jh1: 1l9j H:36-253 [73724]
   Other proteins in same PDB: d1l9jc_, d1l9jd_, d1l9jh2, d1l9jl1, d1l9jm1, d1l9jr1, d1l9js1, d1l9jt2

Details for d1l9jh1

PDB Entry: 1l9j, 3.25 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type I Co-Crystals

SCOP Domain Sequences for d1l9jh1:

Sequence; same for both SEQRES and ATOM records:

>d1l9jh1 b.41.1.1 (H:36-253) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvva

Timeline for d1l9jh1:

• d1l9jh1 is new in SCOP 1.61
  
• d1l9jh1 appears in SCOP 1.63
  
• d1l9jh1 appears in the current release, SCOPe 2.08