Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.2: Rhodopsin-like [81320] (2 proteins) Individual TM segments have a number of kinks and distortions |
Protein Rhodopsin [56876] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [56877] (9 PDB entries) Uniprot P02699 |
Domain d1l9ha_: 1l9h A: [73720] complexed with bng, hg, hto, plm, ret, zn |
PDB Entry: 1l9h (more details), 2.6 Å
SCOPe Domain Sequences for d1l9ha_:
Sequence, based on SEQRES records: (download)
>d1l9ha_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa
>d1l9ha_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaattqk aekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsavynpvi yimmnkqfrncmvttlccgknplgdsttvsktetsqvapa
Timeline for d1l9ha_: