Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries) |
Domain d1l9bl_: 1l9b L: [73714] Other proteins in same PDB: d1l9bc_, d1l9bh1, d1l9bh2, d1l9bm_ complexed with bcl, bph, cl, fe2, hem, hto, lda, na, u10 |
PDB Entry: 1l9b (more details), 2.4 Å
SCOP Domain Sequences for d1l9bl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9bl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1l9bl_:
View in 3D Domains from other chains: (mouse over for more information) d1l9bc_, d1l9bh1, d1l9bh2, d1l9bm_ |