Lineage for d1l8ta_ (1l8t A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197199Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 197200Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 197491Family d.144.1.6: Type IIIa 3',5"-aminoglycoside phosphotransferase [64411] (1 protein)
  6. 197492Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)
  7. 197493Species Enterococcus faecalis [TaxId:1351] [64413] (5 PDB entries)
  8. 197498Domain d1l8ta_: 1l8t A: [73702]

Details for d1l8ta_

PDB Entry: 1l8t (more details), 2.4 Å

PDB Description: Crystal Structure Of 3',5"-Aminoglycoside Phosphotransferase Type IIIa ADP Kanamycin A Complex

SCOP Domain Sequences for d1l8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ta_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

SCOP Domain Coordinates for d1l8ta_:

Click to download the PDB-style file with coordinates for d1l8ta_.
(The format of our PDB-style files is described here.)

Timeline for d1l8ta_: