Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein Enolase [51606] (11 species) Fold of this protein slightly differs from common fold in topology |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (16 PDB entries) |
Domain d1l8pb1: 1l8p B:642-936 [73694] Other proteins in same PDB: d1l8pa2, d1l8pb2, d1l8pc2, d1l8pd2 complexed with mg, pah |
PDB Entry: 1l8p (more details), 2.1 Å
SCOPe Domain Sequences for d1l8pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8pb1 c.1.11.1 (B:642-936) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl
Timeline for d1l8pb1: