Lineage for d1l8ka_ (1l8k A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) 
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) Protein Tyrosine phosphatase [52806] (8 species) 
Species Human (Homo sapiens), T-cell [TaxId:9606] [75233] (1 PDB entry) 
Domain d1l8ka_: 1l8k A: [73691]
Details for d1l8ka_
PDB Entry: 1l8k (more details), 2.56 Å
PDB Description: T Cell Protein-Tyrosine Phosphatase Structure
SCOP Domain Sequences for d1l8ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell}
ierefeeldtqrrwqplyleirneshdyphrvakfpenrnrnryrdvspydhsrvklqna
endyinaslvdieeaqrsyiltqgplpntcchfwlmvwqqktkavvmlnrivekesvkca
qywptddqemlfketgfsvkllsedvksyytvhllqleninsgetrtishfhyttwpdfg
vpespasflnflfkvresgslnpdhgpavihcsagigrsgtfslvdtclvlmekgddini
kqvllnmrkyrmgliqtpdqlrfsymaiiegak
SCOP Domain Coordinates for d1l8ka_:
Click to download the PDB-style file with coordinates for d1l8ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l8ka_:
- d1l8ka_ is new in SCOP 1.61
- d1l8ka_ appears in SCOP 1.63
- d1l8ka_ appears in the current release, SCOPe 2.08
View in 3D