Lineage for d1l8ab1 (1l8a B:56-470)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393047Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 393048Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 393269Family c.36.1.10: TK-like PP module [88760] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 393270Protein Pyruvate dehydrogenase E1 component, PP module [88764] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 393271Species Escherichia coli [TaxId:562] [88765] (2 PDB entries)
  8. 393273Domain d1l8ab1: 1l8a B:56-470 [73680]
    Other proteins in same PDB: d1l8aa2, d1l8aa3, d1l8ab2, d1l8ab3
    complexed with mg, tdp

Details for d1l8ab1

PDB Entry: 1l8a (more details), 1.85 Å

PDB Description: e. coli pyruvate dehydrogenase

SCOP Domain Sequences for d1l8ab1:

Sequence, based on SEQRES records: (download)

>d1l8ab1 c.36.1.10 (B:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli}
isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmd
gvrhirdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft

Sequence, based on observed residues (ATOM records): (download)

>d1l8ab1 c.36.1.10 (B:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli}
isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft

SCOP Domain Coordinates for d1l8ab1:

Click to download the PDB-style file with coordinates for d1l8ab1.
(The format of our PDB-style files is described here.)

Timeline for d1l8ab1: