Lineage for d1l8aa3 (1l8a A:701-886)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245392Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 245393Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 245394Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 245395Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 245396Species Escherichia coli [TaxId:562] [75240] (1 PDB entry)
  8. 245397Domain d1l8aa3: 1l8a A:701-886 [73679]
    Other proteins in same PDB: d1l8aa1, d1l8aa2, d1l8ab1, d1l8ab2

Details for d1l8aa3

PDB Entry: 1l8a (more details), 1.85 Å

PDB Description: e. coli pyruvate dehydrogenase

SCOP Domain Sequences for d1l8aa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8aa3 c.48.1.1 (A:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOP Domain Coordinates for d1l8aa3:

Click to download the PDB-style file with coordinates for d1l8aa3.
(The format of our PDB-style files is described here.)

Timeline for d1l8aa3: