![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.6: BM-002-like [75362] (3 proteins) Pfam PF03671; UPF0185; this family comprises small uncharacterized proteins including human protein BM-002 |
![]() | Protein Hypothetical protein zk652.3 [75363] (1 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [75364] (1 PDB entry) |
![]() | Domain d1l7ya_: 1l7y A: [73676] structural genomics |
PDB Entry: 1l7y (more details)
SCOPe Domain Sequences for d1l7ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l7ya_ d.15.1.6 (A:) Hypothetical protein zk652.3 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} msggtaattagskvtfkitltsdpklpfkvlsvpestpftavlkfaaeefkvpaatsaii tndgvgvnpaqpagniflkhgselrliprdrvgh
Timeline for d1l7ya_: