Lineage for d1l7ya_ (1l7y A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189215Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 189341Family d.15.1.6: Hypothetical protein zk652.3 [75362] (1 protein)
  6. 189342Protein Hypothetical protein zk652.3 [75363] (1 species)
  7. 189343Species Caenorhabditis elegans [75364] (1 PDB entry)
  8. 189344Domain d1l7ya_: 1l7y A: [73676]

Details for d1l7ya_

PDB Entry: 1l7y (more details)

PDB Description: solution nmr structure of c. elegans protein zk652.3. northeast structural genomics consortium target wr41.

SCOP Domain Sequences for d1l7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7ya_ d.15.1.6 (A:) Hypothetical protein zk652.3 {Caenorhabditis elegans}
msggtaattagskvtfkitltsdpklpfkvlsvpestpftavlkfaaeefkvpaatsaii
tndgvgvnpaqpagniflkhgselrliprdrvgh

SCOP Domain Coordinates for d1l7ya_:

Click to download the PDB-style file with coordinates for d1l7ya_.
(The format of our PDB-style files is described here.)

Timeline for d1l7ya_: