Lineage for d1l6xb_ (1l6x B:)

  1. Root: SCOP 1.75
  2. 900990Class k: Designed proteins [58788] (44 folds)
  3. 901344Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)
  4. 901345Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) (S)
  5. 901346Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)
  6. 901347Protein Protein A Ig(Fc)-binding domain mimics [58866] (1 species)
  7. 901348Species Synthetic [58867] (7 PDB entries)
  8. 901349Domain d1l6xb_: 1l6x B: [73644]
    Other proteins in same PDB: d1l6xa1, d1l6xa2
    bound to Fc fragment of rituximab IgG1
    complexed with fuc, gal, man, nag

Details for d1l6xb_

PDB Entry: 1l6x (more details), 1.65 Å

PDB Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c
PDB Compounds: (B:) Minimized B-domain of Protein A Z34C

SCOP Domain Sequences for d1l6xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6xb_ k.13.1.1 (B:) Protein A Ig(Fc)-binding domain mimics {Synthetic}
fnmqcqrrfyealhdpnlneeqrnakiksirddc

SCOP Domain Coordinates for d1l6xb_:

Click to download the PDB-style file with coordinates for d1l6xb_.
(The format of our PDB-style files is described here.)

Timeline for d1l6xb_: