Lineage for d1l6xb_ (1l6x B:)

  1. Root: SCOP 1.63
  2. 275300Class k: Designed proteins [58788] (37 folds)
  3. 275483Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)
  4. 275484Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) (S)
  5. 275485Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)
  6. 275486Protein Protein A Ig(Fc)-binding domain mimics [58866] (1 species)
  7. 275487Species Synthetic [58867] (5 PDB entries)
  8. 275488Domain d1l6xb_: 1l6x B: [73644]
    Other proteins in same PDB: d1l6xa1, d1l6xa2
    bound to Fc fragment of rituximab IgG1
    complexed with fuc, gal, man, nag

Details for d1l6xb_

PDB Entry: 1l6x (more details), 1.65 Å

PDB Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c

SCOP Domain Sequences for d1l6xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6xb_ k.13.1.1 (B:) Protein A Ig(Fc)-binding domain mimics {Synthetic}
fnmqcqrrfyealhdpnlneeqrnakiksirddc

SCOP Domain Coordinates for d1l6xb_:

Click to download the PDB-style file with coordinates for d1l6xb_.
(The format of our PDB-style files is described here.)

Timeline for d1l6xb_: