Lineage for d1l6xa2 (1l6x A:342-443)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655861Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 655864Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries)
  8. 655865Domain d1l6xa2: 1l6x A:342-443 [73643]
    Other proteins in same PDB: d1l6xa1, d1l6xb_
    part of a Fc
    complexed with fuc, gal, man, nag

Details for d1l6xa2

PDB Entry: 1l6x (more details), 1.65 Å

PDB Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c
PDB Compounds: (A:) immunoglobulin gamma-1 heavy chain constant region

SCOP Domain Sequences for d1l6xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1l6xa2:

Click to download the PDB-style file with coordinates for d1l6xa2.
(The format of our PDB-style files is described here.)

Timeline for d1l6xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6xa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1l6xb_