SCOP 1.73: Domain d1l6xa1: 1l6x A:237-341

Lineage for d1l6xa1 (1l6x A:237-341)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)

8. Domain d1l6xa1: 1l6x A:237-341 [73642]
   Other proteins in same PDB: d1l6xa2, d1l6xb_
   part of a Fc
   complexed with fuc, gal, man, nag

Details for d1l6xa1

PDB Entry: 1l6x, 1.65 Å

PDB Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c

PDB Compounds: (A:) immunoglobulin gamma-1 heavy chain constant region

SCOP Domain Sequences for d1l6xa1:

Sequence; same for both SEQRES and ATOM records:

>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d1l6xa1:

• d1l6xa1 first appeared in SCOP 1.61
  
• d1l6xa1 appears in SCOP 1.71
  
• d1l6xa1 appears in SCOP 1.75
  
• d1l6xa1 appears in the current release, SCOPe 2.07