Lineage for d1l6xa1 (1l6x A:237-341)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 160050Species Fc (human) IgG1 class [49120] (9 PDB entries)
  8. 160051Domain d1l6xa1: 1l6x A:237-341 [73642]
    Other proteins in same PDB: d1l6xb_

Details for d1l6xa1

PDB Entry: 1l6x (more details), 1.65 Å

PDB Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c
PDB Compounds: (A:)

SCOP Domain Sequences for d1l6xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1l6xa1:

Click to download the PDB-style file with coordinates for d1l6xa1.
(The format of our PDB-style files is described here.)

Timeline for d1l6xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6xa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1l6xb_