Lineage for d1l6va_ (1l6v A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189382Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 189383Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 189446Protein Adrenodoxin [54310] (1 species)
  7. 189447Species Cow (Bos taurus) [TaxId:9913] [54311] (5 PDB entries)
  8. 189457Domain d1l6va_: 1l6v A: [73631]

Details for d1l6va_

PDB Entry: 1l6v (more details)

PDB Description: structure of reduced bovine adrenodoxin

SCOP Domain Sequences for d1l6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6va_ d.15.4.1 (A:) Adrenodoxin {Cow (Bos taurus)}
dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif
ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpda

SCOP Domain Coordinates for d1l6va_:

Click to download the PDB-style file with coordinates for d1l6va_.
(The format of our PDB-style files is described here.)

Timeline for d1l6va_: