Lineage for d1l6ua_ (1l6u A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254175Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 254176Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 254239Protein Adrenodoxin [54310] (1 species)
  7. 254240Species Cow (Bos taurus) [TaxId:9913] [54311] (5 PDB entries)
  8. 254249Domain d1l6ua_: 1l6u A: [73630]
    complexed with fes

Details for d1l6ua_

PDB Entry: 1l6u (more details)

PDB Description: nmr structure of oxidized adrenodoxin

SCOP Domain Sequences for d1l6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ua_ d.15.4.1 (A:) Adrenodoxin {Cow (Bos taurus)}
sssedkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlife
qhifekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp

SCOP Domain Coordinates for d1l6ua_:

Click to download the PDB-style file with coordinates for d1l6ua_.
(The format of our PDB-style files is described here.)

Timeline for d1l6ua_: