SCOP 1.71: Domain d1l6na2: 1l6n A:131-289

Lineage for d1l6na2 (1l6n A:131-289)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (11 PDB entries)

8. Domain d1l6na2: 1l6n A:131-289 [73625]
   Other proteins in same PDB: d1l6na1

Details for d1l6na2

PDB Entry: 1l6n

PDB Description: structure of the n-terminal 283-residue fragment of the hiv-1 gag polyprotein

SCOP Domain Sequences for d1l6na2:

Sequence; same for both SEQRES and ATOM records:

>d1l6na2 a.73.1.1 (A:131-289) HIV-1 capsid protein {Human immunodeficiency virus type 1}
nypivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlnt
vgghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwm
thnppipvgeiykrwiilglnkivrmysptsilhhhhhh

Timeline for d1l6na2:

• d1l6na2 first appeared in SCOP 1.61
  
• d1l6na2 appears in SCOP 1.69
  
• d1l6na2 appears in SCOP 1.73
  
• d1l6na2 appears in the current release, SCOPe 2.08