SCOP 1.63: Domain d1l6na1: 1l6n A:2-130

Lineage for d1l6na1 (1l6n A:2-130)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (2 proteins)

6. Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
   topologically similar to one subunit in the interferon-gamma intertwined dimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (4 PDB entries)

8. Domain d1l6na1: 1l6n A:2-130 [73624]
   Other proteins in same PDB: d1l6na2

Details for d1l6na1

PDB Entry: 1l6n

PDB Description: structure of the n-terminal 283-residue fragment of the hiv-1 gag polyprotein

SCOP Domain Sequences for d1l6na1:

Sequence; same for both SEQRES and ATOM records:

>d1l6na1 a.61.1.1 (A:2-130) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1}
garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
tgnnsqvsq

Timeline for d1l6na1:

• d1l6na1 first appeared in SCOP 1.61
  
• d1l6na1 appears in SCOP 1.65
  
• d1l6na1 appears in the current release, SCOPe 2.08