Lineage for d1l6ja4 (1l6j A:275-331)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 522773Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 522774Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 522852Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 522887Protein Gelatinase B (MMP-9) type II modules [75674] (1 species)
    duplication: tandem repeat of three modules inserted in the catalytic domain
  7. 522888Species Human (Homo sapiens) [TaxId:9606] [75675] (1 PDB entry)
  8. 522890Domain d1l6ja4: 1l6j A:275-331 [73622]
    Other proteins in same PDB: d1l6ja1, d1l6ja2

Details for d1l6ja4

PDB Entry: 1l6j (more details), 2.5 Å

PDB Description: Crystal structure of human matrix metalloproteinase MMP9 (gelatinase B).

SCOP Domain Sequences for d1l6ja4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ja4 g.14.1.2 (A:275-331) Gelatinase B (MMP-9) type II modules {Human (Homo sapiens)}
rlytrdgnadgkpcqfpfifqgqsysacttdgrsdgyrwcattanydrdklfgfcpt

SCOP Domain Coordinates for d1l6ja4:

Click to download the PDB-style file with coordinates for d1l6ja4.
(The format of our PDB-style files is described here.)

Timeline for d1l6ja4: