SCOPe 2.08: Domain d1l6ga2: 1l6g A:12-244

Lineage for d1l6ga2 (1l6g A:12-244)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)

6. Protein Alanine racemase [51421] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries)

8. Domain d1l6ga2: 1l6g A:12-244 [73614]
   Other proteins in same PDB: d1l6ga1, d1l6gb1
   complexed with pdd

Details for d1l6ga2

PDB Entry: 1l6g, 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-D-alanine

PDB Compounds: (A:) alanine racemase

SCOPe Domain Sequences for d1l6ga2:

Sequence; same for both SEQRES and ATOM records:

>d1l6ga2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

Timeline for d1l6ga2:

• d1l6ga2 first appeared in SCOP 1.61
  
• d1l6ga2 appears in SCOPe 2.07