![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
![]() | Family b.49.2.2: Alanine racemase [88682] (1 protein) |
![]() | Protein Alanine racemase [50623] (3 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries) |
![]() | Domain d1l6ga1: 1l6g A:2-11,A:245-383 [73613] Other proteins in same PDB: d1l6ga2, d1l6gb2 |
PDB Entry: 1l6g (more details), 2 Å
SCOP Domain Sequences for d1l6ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ga1 b.49.2.2 (A:2-11,A:245-383) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]} ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin yevpctisyrvpriffrhkrimevrnaigr
Timeline for d1l6ga1: