Lineage for d1l6ga1 (1l6g A:2-11,A:245-383)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562760Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 562853Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 562854Family b.49.2.2: Alanine racemase [88682] (1 protein)
  6. 562855Protein Alanine racemase [50623] (3 species)
  7. 562856Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries)
  8. 562863Domain d1l6ga1: 1l6g A:2-11,A:245-383 [73613]
    Other proteins in same PDB: d1l6ga2, d1l6gb2

Details for d1l6ga1

PDB Entry: 1l6g (more details), 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-D-alanine

SCOP Domain Sequences for d1l6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ga1 b.49.2.2 (A:2-11,A:245-383) Alanine racemase {Bacillus stearothermophilus}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaigr

SCOP Domain Coordinates for d1l6ga1:

Click to download the PDB-style file with coordinates for d1l6ga1.
(The format of our PDB-style files is described here.)

Timeline for d1l6ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6ga2