Class b: All beta proteins [48724] (111 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) |
Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) |
Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins) |
Protein Alanine racemase [50623] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [50624] (5 PDB entries) |
Domain d1l6ga1: 1l6g A:2-11,A:245-383 [73613] Other proteins in same PDB: d1l6ga2, d1l6gb2 |
PDB Entry: 1l6g (more details), 2 Å
SCOP Domain Sequences for d1l6ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ga1 b.49.2.1 (A:2-11,A:245-383) Alanine racemase {Bacillus stearothermophilus} ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin yevpctisyrvpriffrhkrimevrnaigr
Timeline for d1l6ga1: