SCOP 1.61: Domain d1l6fb2: 1l6f B:12-244

Lineage for d1l6fb2 (1l6f B:12-244)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (2 proteins)

6. Protein Alanine racemase [51421] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51422] (5 PDB entries)

8. Domain d1l6fb2: 1l6f B:12-244 [73612]
   Other proteins in same PDB: d1l6fa1, d1l6fb1

Details for d1l6fb2

PDB Entry: 1l6f, 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-L-alanine

SCOP Domain Sequences for d1l6fb2:

Sequence; same for both SEQRES and ATOM records:

>d1l6fb2 c.1.6.1 (B:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

Timeline for d1l6fb2:

• d1l6fb2 is new in SCOP 1.61
  
• d1l6fb2 appears in SCOP 1.63
  
• d1l6fb2 appears in the current release, SCOPe 2.08