Lineage for d1l6fb1 (1l6f B:2-11,B:245-383)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1129800Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1129907Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 1129908Family b.49.2.2: Alanine racemase [88682] (1 protein)
  6. 1129909Protein Alanine racemase [50623] (3 species)
  7. 1129910Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries)
  8. 1129918Domain d1l6fb1: 1l6f B:2-11,B:245-383 [73611]
    Other proteins in same PDB: d1l6fa2, d1l6fb2
    complexed with pp3

Details for d1l6fb1

PDB Entry: 1l6f (more details), 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-L-alanine
PDB Compounds: (B:) alanine racemase

SCOPe Domain Sequences for d1l6fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6fb1 b.49.2.2 (B:2-11,B:245-383) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaigr

SCOPe Domain Coordinates for d1l6fb1:

Click to download the PDB-style file with coordinates for d1l6fb1.
(The format of our PDB-style files is described here.)

Timeline for d1l6fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6fb2