SCOP 1.61: Domain d1l6fb1: 1l6f B:2-11,B:245-383

Lineage for d1l6fb1 (1l6f B:2-11,B:245-383)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family)

5. Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)

6. Protein Alanine racemase [50623] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50624] (5 PDB entries)

8. Domain d1l6fb1: 1l6f B:2-11,B:245-383 [73611]
   Other proteins in same PDB: d1l6fa2, d1l6fb2

Details for d1l6fb1

PDB Entry: 1l6f, 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-L-alanine

SCOP Domain Sequences for d1l6fb1:

Sequence; same for both SEQRES and ATOM records:

>d1l6fb1 b.49.2.1 (B:2-11,B:245-383) Alanine racemase {Bacillus stearothermophilus}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaigr

Timeline for d1l6fb1:

• d1l6fb1 is new in SCOP 1.61
  
• d1l6fb1 appears in SCOP 1.63
  
• d1l6fb1 appears in the current release, SCOPe 2.08