![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) |
![]() | Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) ![]() |
![]() | Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins) |
![]() | Protein Alanine racemase [50623] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [50624] (5 PDB entries) |
![]() | Domain d1l6fb1: 1l6f B:2-11,B:245-383 [73611] Other proteins in same PDB: d1l6fa2, d1l6fb2 |
PDB Entry: 1l6f (more details), 2 Å
SCOP Domain Sequences for d1l6fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6fb1 b.49.2.1 (B:2-11,B:245-383) Alanine racemase {Bacillus stearothermophilus} ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin yevpctisyrvpriffrhkrimevrnaigr
Timeline for d1l6fb1: