Lineage for d1l6fa2 (1l6f A:12-244)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173100Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
  5. 173101Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (2 proteins)
  6. 173102Protein Alanine racemase [51421] (1 species)
  7. 173103Species Bacillus stearothermophilus [TaxId:1422] [51422] (5 PDB entries)
  8. 173108Domain d1l6fa2: 1l6f A:12-244 [73610]
    Other proteins in same PDB: d1l6fa1, d1l6fb1

Details for d1l6fa2

PDB Entry: 1l6f (more details), 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-L-alanine

SCOP Domain Sequences for d1l6fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6fa2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

SCOP Domain Coordinates for d1l6fa2:

Click to download the PDB-style file with coordinates for d1l6fa2.
(The format of our PDB-style files is described here.)

Timeline for d1l6fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6fa1