Class b: All beta proteins [48724] (174 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.2: Alanine racemase [88682] (1 protein) |
Protein Alanine racemase [50623] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries) |
Domain d1l6fa1: 1l6f A:2-11,A:245-383 [73609] Other proteins in same PDB: d1l6fa2, d1l6fb2 complexed with pp3 |
PDB Entry: 1l6f (more details), 2 Å
SCOPe Domain Sequences for d1l6fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6fa1 b.49.2.2 (A:2-11,A:245-383) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]} ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin yevpctisyrvpriffrhkrimevrnaigr
Timeline for d1l6fa1: