Class a: All alpha proteins [46456] (258 folds) |
Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family) dimer of identical alpha-hairpin motifs |
Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins) |
Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries) |
Domain d1l6ea_: 1l6e A: [73607] |
PDB Entry: 1l6e (more details)
SCOP Domain Sequences for d1l6ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ea_ a.31.1.1 (A:) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]} hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
Timeline for d1l6ea_: