SCOPe 2.08: Domain d1l5gb4: 1l5g B:532-562

Lineage for d1l5gb4 (1l5g B:532-562)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)

6. Protein Integrin beta EGF-like domains [69941] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries)
   Uniprot P05106 27-716

8. Domain d1l5gb4: 1l5g B:532-562 [73588]
   Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb3
   complexed with mn, nag

Details for d1l5gb4

PDB Entry: 1l5g, 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand

PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1l5gb4:

Sequence; same for both SEQRES and ATOM records:

>d1l5gb4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
kgemcsghgqcscgdclcdsdwtgyycnctt

Timeline for d1l5gb4:

• d1l5gb4 first appeared in SCOP 1.61
  
• d1l5gb4 appears in SCOPe 2.07