![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.200: Integrin beta tail domain [69686] (1 superfamily) alpha-beta-loop-beta(3); loop across free side of beta-sheet |
![]() | Superfamily d.200.1: Integrin beta tail domain [69687] (1 family) ![]() |
![]() | Family d.200.1.1: Integrin beta tail domain [69688] (1 protein) |
![]() | Protein Integrin beta tail domain [69689] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69690] (3 PDB entries) |
![]() | Domain d1l5gb3: 1l5g B:606-690 [73587] Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb4, d1l5gb5 |
PDB Entry: 1l5g (more details), 3.2 Å
SCOP Domain Sequences for d1l5gb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5gb3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens)} dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv rfqyyedssgksilyvveepecpkg
Timeline for d1l5gb3:
![]() Domains from same chain: (mouse over for more information) d1l5gb1, d1l5gb2, d1l5gb4, d1l5gb5 |
![]() Domains from other chains: (mouse over for more information) d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4 |