SCOPe 2.06: Domain d1l5gb1: 1l5g B:55-106,B:355-434

Lineage for d1l5gb1 (1l5g B:55-106,B:355-434)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (2 families)

5. Family b.1.15.1: Integrin domains [69180] (2 proteins)

6. Protein Hybrid domain of integrin beta [69183] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries)
   Uniprot P05106 27-466

8. Domain d1l5gb1: 1l5g B:55-106,B:355-434 [73585]
   Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5
   complexed with mn, nag

Details for d1l5gb1

PDB Entry: 1l5g, 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand

PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1l5gb1:

Sequence; same for both SEQRES and ATOM records:

>d1l5gb1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd
lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf
kdslivqvtfdcd

Timeline for d1l5gb1:

• d1l5gb1 first appeared in SCOP 1.61
  
• d1l5gb1 appears in SCOPe 2.05
  
• d1l5gb1 appears in SCOPe 2.07
  
• d1l5gb1 appears in the current release, SCOPe 2.08