Lineage for d1l5ac_ (1l5a C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180636Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
  4. 180637Superfamily c.43.1: CoA-dependent acyltransferases [52777] (2 families) (S)
  5. 180672Family c.43.1.2: NRPS condensation domain (amide synthase) [75229] (1 protein)
  6. 180673Protein VibH [75230] (1 species)
  7. 180674Species Vibrio cholerae [TaxId:666] [75231] (1 PDB entry)
  8. 180677Domain d1l5ac_: 1l5a C: [73574]

Details for d1l5ac_

PDB Entry: 1l5a (more details), 2.55 Å

PDB Description: Crystal Structure of VibH, an NRPS Condensation Enzyme

SCOP Domain Sequences for d1l5ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5ac_ c.43.1.2 (C:) VibH {Vibrio cholerae}
mllaqkpfwqrhlayphinldtvahslrltgpldttlllralhltvseidlfrarfsaqg
elywhpfsppidyqdlsihleaeplawrqieqdlqrsstlidapitshqvyrlshsehli
ytrahhivldgygmmlfeqrlsqhyqsllsgqtptaafkpyqsyleeeaayltshrywqd
kqfwqgylreapdltltsatydpqlshavslsytlnsqlnhlllklananqigwpdalva
lcalylesaepdapwlwlpfmnrwgsvaanvpglmvnslpllrlsaqqtslgnylkqsgq
airslylhgryrieqieqdqglnaeqsyfmspfinilpfesphfadcqtelkvlasgsae
ginftfrgspqhelclditadlasypqshwqshcerfprffeqllarfqqveqdvarlla
epaa

SCOP Domain Coordinates for d1l5ac_:

Click to download the PDB-style file with coordinates for d1l5ac_.
(The format of our PDB-style files is described here.)

Timeline for d1l5ac_: