Lineage for d1l4ab_ (1l4a B:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431612Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 431613Family h.1.15.1: SNARE fusion complex [58039] (10 proteins)
  6. 431653Protein Syntaxin 1A [88908] (2 species)
  7. 431654Species Longfin squid (Loligo pealei) [TaxId:6621] [88910] (1 PDB entry)
  8. 431655Domain d1l4ab_: 1l4a B: [73560]
    Other proteins in same PDB: d1l4aa_, d1l4ac_, d1l4ad_, d1l4ae_
    complex with SNAP25, synaptobrevin and synaphin fragments

Details for d1l4ab_

PDB Entry: 1l4a (more details), 2.95 Å

PDB Description: x-ray structure of the neuronal complexin/snare complex from the squid loligo pealei

SCOP Domain Sequences for d1l4ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l4ab_ h.1.15.1 (B:) Syntaxin 1A {Longfin squid (Loligo pealei)}
gksasgiimetqqakqtladiearhadimkletsirelhdmfmdmamlvesqgemidrie
ynveaavdyietakvdtkkavk

SCOP Domain Coordinates for d1l4ab_:

Click to download the PDB-style file with coordinates for d1l4ab_.
(The format of our PDB-style files is described here.)

Timeline for d1l4ab_: