Lineage for d1l4ab1 (1l4a B:183-259)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591003Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2591004Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2591073Protein Syntaxin 1A [88908] (3 species)
  7. 2591078Species Longfin inshore squid (Loligo pealei) [TaxId:6621] [88910] (1 PDB entry)
  8. 2591079Domain d1l4ab1: 1l4a B:183-259 [73560]
    Other proteins in same PDB: d1l4aa_, d1l4ab2, d1l4ac_, d1l4ad_, d1l4ae_
    complex with SNAP25, synaptobrevin and synaphin fragments

Details for d1l4ab1

PDB Entry: 1l4a (more details), 2.95 Å

PDB Description: x-ray structure of the neuronal complexin/snare complex from the squid loligo pealei
PDB Compounds: (B:) s-syntaxin

SCOPe Domain Sequences for d1l4ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l4ab1 h.1.15.1 (B:183-259) Syntaxin 1A {Longfin inshore squid (Loligo pealei) [TaxId: 6621]}
giimetqqakqtladiearhadimkletsirelhdmfmdmamlvesqgemidrieynvea
avdyietakvdtkkavk

SCOPe Domain Coordinates for d1l4ab1:

Click to download the PDB-style file with coordinates for d1l4ab1.
(The format of our PDB-style files is described here.)

Timeline for d1l4ab1: