Lineage for d1l4aa_ (1l4a A:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345390Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 345391Family h.1.15.1: SNARE fusion complex [58039] (10 proteins)
  6. 345401Protein Synaptobrevin [88903] (2 species)
  7. 345402Species Longfin squid (Loligo pealei) [TaxId:6621] [88905] (1 PDB entry)
  8. 345403Domain d1l4aa_: 1l4a A: [73559]
    Other proteins in same PDB: d1l4ab_, d1l4ac_, d1l4ad_, d1l4ae_
    complex with SNAP25, syntaxin and synaphin fragments

Details for d1l4aa_

PDB Entry: 1l4a (more details), 2.95 Å

PDB Description: x-ray structure of the neuronal complexin/snare complex from the squid loligo pealei

SCOP Domain Sequences for d1l4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l4aa_ h.1.15.1 (A:) Synaptobrevin {Longfin squid (Loligo pealei)}
qpvqqskrlqqtqaqveevvdimrvnvdkvlerdskiselddradalqagasqfeasagk
lkrkfw

SCOP Domain Coordinates for d1l4aa_:

Click to download the PDB-style file with coordinates for d1l4aa_.
(The format of our PDB-style files is described here.)

Timeline for d1l4aa_: