Lineage for d1l3ya_ (1l3y A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 622118Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 622449Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 622450Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 622451Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries)
  8. 622460Domain d1l3ya_: 1l3y A: [73558]
    EGF-like module 3

Details for d1l3ya_

PDB Entry: 1l3y (more details)

PDB Description: integrin egf-like module 3 from the beta-2 subunit

SCOP Domain Sequences for d1l3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens)}
ecdtinceryngqvcggpgrglcfcgkcrchpgfegsacqa

SCOP Domain Coordinates for d1l3ya_:

Click to download the PDB-style file with coordinates for d1l3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1l3ya_: