Lineage for d1l3ya_ (1l3y A:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202990Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 203221Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 203222Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 203223Species Human (Homo sapiens) [TaxId:9606] [69942] (4 PDB entries)
  8. 203230Domain d1l3ya_: 1l3y A: [73558]

Details for d1l3ya_

PDB Entry: 1l3y (more details)

PDB Description: integrin egf-like module 3 from the beta-2 subunit

SCOP Domain Sequences for d1l3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens)}
ecdtinceryngqvcggpgrglcfcgkcrchpgfegsacqa

SCOP Domain Coordinates for d1l3ya_:

Click to download the PDB-style file with coordinates for d1l3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1l3ya_: