Lineage for d1l3na_ (1l3n A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161486Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 161487Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 161500Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 161556Species Human (Homo sapiens) [TaxId:9606] [49333] (8 PDB entries)
  8. 161581Domain d1l3na_: 1l3n A: [73549]

Details for d1l3na_

PDB Entry: 1l3n (more details)

PDB Description: The Solution Structure of Reduced Dimeric Copper Zinc SOD: the Structural Effects of Dimerization

SCOP Domain Sequences for d1l3na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3na_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOP Domain Coordinates for d1l3na_:

Click to download the PDB-style file with coordinates for d1l3na_.
(The format of our PDB-style files is described here.)

Timeline for d1l3na_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l3nb_