SCOP 1.75: Domain d1l3lc1: 1l3l C:172-234

Lineage for d1l3lc1 (1l3l C:172-234)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
   contains additional, fourth helix in the C-terminal extension

6. Protein Quorum-sensing transcription factor TraR, C-terminal domain [74690] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [74691] (2 PDB entries)

8. Domain d1l3lc1: 1l3l C:172-234 [73545]
   Other proteins in same PDB: d1l3la2, d1l3lb2, d1l3lc2, d1l3ld2

Details for d1l3lc1

PDB Entry: 1l3l, 1.66 Å

PDB Description: crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna

PDB Compounds: (C:) transcriptional activator protein trar

SCOP Domain Sequences for d1l3lc1:

Sequence; same for both SEQRES and ATOM records:

>d1l3lc1 a.4.6.2 (C:172-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
awldpkeatylrwiavgktmeeiadvegvkynsvrvklreamkrfdvrskahltalairr
kli

Timeline for d1l3lc1:

• d1l3lc1 first appeared in SCOP 1.61
  
• d1l3lc1 appears in SCOP 1.73
  
• d1l3lc1 appears in SCOPe 2.01
  
• d1l3lc1 appears in the current release, SCOPe 2.08