Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins) contains additional, fourth helix in the C-terminal extension |
Protein Quorum-sensing transcription factor TraR, C-terminal domain [74690] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [74691] (2 PDB entries) |
Domain d1l3lb1: 1l3l B:170-234 [73543] Other proteins in same PDB: d1l3la2, d1l3lb2, d1l3lc2, d1l3ld2 |
PDB Entry: 1l3l (more details), 1.66 Å
SCOP Domain Sequences for d1l3lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3lb1 a.4.6.2 (B:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} daawldpkeatylrwiavgktmeeiadvegvkynsvrvklreamkrfdvrskahltalai rrkli
Timeline for d1l3lb1: