Lineage for d1l2sb_ (1l2s B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries)
  8. Domain d1l2sb_: 1l2s B: [73513]
    complexed with stc

Details for d1l2sb_

PDB Entry: 1l2s (more details), 1.94 Å

PDB Description: X-ray crystal structure of AmpC beta-lactamase from E. coli in complex with a DOCK-predicted non-covalent inhibitor
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1l2sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2sb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d1l2sb_ are not available.

Timeline for d1l2sb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l2sa_